Abnova™ Human PPBP Full-length ORF (NP_002695.1, 1 a.a. - 128 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-957-745	10 ug
89-957-746	25 ug

Catalog No. 89-957-745 Supplier Abnova™ Supplier No. H00005473P01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and sythesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. [provided by RefSeq]

Sequence: MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Specifications

• Accession Number: NP_002695.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5473
• Molecular Weight (g/mol): 40.3kDa
• Name: PPBP (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: B-TG1/Beta-TG/CTAP-III/CTAP3/CTAPIII/CXCL7/LA-PF4/LDGF/MDGF/NAP-2/PBP/SCYB7/TC1/TC2/TGB/TGB1/THBGB/THBGB1
• Common Name: PPBP
• Gene Symbol: PPBP
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid