Abnova™ Human PPIA (NP_066953, 1 a.a. - 165 a.a.) Full-length Recombinant Protein

Catalog No.	Quantity
89-957-768	100 μg

Catalog No. 89-957-768 Supplier Abnova™ Supplier No. P3460

Description

Used for Func, SDS-PAGE

This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Specifications

• Accession Number: NP_066953
• Concentration: 1 mg/mL
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Liquid
• Gene ID (Entrez): 5478
• Molecular Weight (g/mol): 20kDa
• Name: PPIA (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Quantity: 100 μg
• Immunogen: MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <1.0 EU/μg of protein (determined by LAL method)
• Gene Alias: CYPA/CYPH/MGC117158/MGC12404/MGC23397
• Common Name: PPIA
• Gene Symbol: PPIA
• Biological Activity: Specific activity is > 270nmoles/min/μg, and is defined as the amount of enzyme that cleaves 1μmole of suc-AAFP-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >95% by SDS-PAGE