Abnova™ Human PPM1G Partial ORF (NP_817092, 462 a.a. - 544 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-957-822	25 ug
89-957-821	10 ug

Catalog No. 89-957-822 Supplier Abnova™ Supplier No. H00005496Q01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq]

Sequence: QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAK

Specifications

• Accession Number: NP_817092
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5496
• Molecular Weight (g/mol): 34.87kDa
• Name: PPM1G (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAK
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MGC1675/MGC2870/PP2CG/PP2CGAMMA/PPP2CG
• Common Name: PPM1G
• Gene Symbol: PPM1G
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid