Abnova™ Human PRDM1 Partial ORF (NP_001189, 1 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-958-018	10 ug
89-958-019	25 ug

Catalog No. 89-958-018 Supplier Abnova™ Supplier No. H00000639Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq]

Sequence: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH

Specifications

• Accession Number: NP_001189
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 639
• Molecular Weight (g/mol): 37.73kDa
• Name: PRDM1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: BLIMP1/MGC118922/MGC118923/MGC118924/MGC118925/PRDI-BF1
• Common Name: PRDM1
• Gene Symbol: PRDM1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid