Abnova™ Human PRG1 Partial ORF (NP_002718, 29 a.a. - 94 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-958-075	10 ug
89-958-076	25 ug

Catalog No. 89-958-075 Supplier Abnova™ Supplier No. H00005552Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. [provided by RefSeq]

Sequence: PTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYS

Specifications

• Accession Number: NP_002718
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5552
• Molecular Weight (g/mol): 33kDa
• Name: PRG1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: PTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ12930/MGC9289/PPG/PRG/PRG1
• Common Name: SRGN
• Gene Symbol: SRGN
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid