Abnova™ Human PRKCDBP Partial ORF (NP_659477, 161 a.a. - 261 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-958-170	10 μg
89-958-171	25 μg

Catalog No. 89-958-170 Supplier Abnova™ Supplier No. H00112464Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein. [provided by RefSeq]

Sequence: EVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA

Specifications

• Accession Number: NP_659477
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 112464
• Molecular Weight (g/mol): 36.85kDa
• Name: PRKCDBP (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: EVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: HSRBC/MGC20400/SRBC
• Common Name: PRKCDBP
• Gene Symbol: PRKCDBP
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid