Abnova™ Human PRPF4B Partial ORF (AAH34969, 581 a.a. - 680 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-958-345	10 μg
89-958-346	25 μg

Catalog No. 89-958-345 Supplier Abnova™ Supplier No. H00008899Q01S

Description

Used for AP, Array, ELISA, WB-Re

Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq]

Sequence: PDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIG

Specifications

• Accession Number: AAH34969
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 8899
• Molecular Weight (g/mol): 36.63kDa
• Name: PRPF4B (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: PDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIG
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: KIAA0536/PR4H/PRP4/PRP4H/PRP4K/dJ1013A10.1
• Common Name: PRPF4B
• Gene Symbol: PRPF4B
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid