Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human PRPS1 Partial ORF (NP_002755, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human PRPS1 Partial ORF (NP_002755, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89958357 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 ug
25 ug
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-958-357 25 ug
89-958-356 10 ug
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-958-357 Supplier Abnova™ Supplier No. H00005631Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosphate synthetase superactivity, Charcot-Marie-Tooth disease X-linked recessive type 5 and Arts Syndrome. [provided by RefSeq]

Sequence: MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKK

Specifications

Accession Number NP_002755
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 5631
Molecular Weight (g/mol) 36.74kDa
Name PRPS1 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 ug
Immunogen MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKK
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias ARTS/CMTX5/KIAA0967/PPRibP/PRSI
Common Name PRPS1
Gene Symbol PRPS1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.