Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human PRR13 Full-length ORF (ADZ15792.1, 1 a.a. - 148 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human PRR13 Full-length ORF (ADZ15792.1, 1 a.a. - 148 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89958376 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-958-376 10 μg
89-958-377 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-958-376 Supplier Abnova™ Supplier No. H00054458P01S

Description

Used for AP, Array, ELISA, WB-Re

Sequence: MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSSSSSSSDSD

Specifications

Accession Number ADZ15792.1
For Use With (Application) Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 54458
Molecular Weight (g/mol) 42.7kDa
Name Human PRR13 Full-length ORF (ADZ15792.1, 1 a.a. - 148 a.a.) Recombinant Protein with GST-tag at N-terminal
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue
Quantity 10 μg
Storage Requirements Store at −80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias DKFZp564J157, FLJ23818, TXR1
Common Name PRR13
Gene Symbol PRR13
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST Tag
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.