Abnova™ Human PRSS15 Partial ORF (NP_004784.2, 661 a.a. - 761 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-958-416	25 μg
89-958-415	10 μg

Catalog No. 89-958-416 Supplier Abnova™ Supplier No. H00009361Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a mitochondrial matrix protein in the Lon family of ATP-dependent proteases. A similar E. coli protein regulates gene expression by targeting specific regulatory proteins for degradation. This protein binds a specific sequence in the light and heavy chain promoters of the mitochondrial genome which are involved in regulation of DNA replication and transcription. [provided by RefSeq]

Sequence: YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTP

Specifications

• Accession Number: NP_004784.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 9361
• Molecular Weight (g/mol): 36.85kDa
• Name: PRSS15 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTP
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: LON/LONP/LonHS/MGC1498/PIM1/PRSS15/hLON
• Common Name: LONP1
• Gene Symbol: LONP1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid