Abnova™ Human PSTPIP1 Partial ORF (NP_003969, 148 a.a. - 247 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-958-618	10 μg
89-958-619	25 μg

Catalog No. 89-958-618 Supplier Abnova™ Supplier No. H00009051Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, negatively affecting CD2-triggered T cell activation. The encoded protein appears to be a scaffold protein and a regulator of the actin cytoskeleton. It has also been shown to bind ABL1, PTPN18, WAS, CD2AP, and PTPN12. Mutations in this gene are a cause of PAPA syndrome. [provided by RefSeq]

Sequence: CRDADDAEQAFERISANGHQKQVEKSQNKARQCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSMQCVKDDE

Specifications

• Accession Number: NP_003969
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 9051
• Molecular Weight (g/mol): 36.74kDa
• Name: PSTPIP1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: CRDADDAEQAFERISANGHQKQVEKSQNKARQCKDSATEAERVYRQSIAQLEKVRAEWEQEHRTTCEAFQLQEFDRLTILRNALWVHSNQLSMQCVKDDE
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CD2BP1/CD2BP1L/CD2BP1S/H-PIP/PAPAS/PSTPIP
• Common Name: PSTPIP1
• Gene Symbol: PSTPIP1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid