Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human PTPN11 Full-length ORF (AAH25181, 1 a.a. - 50 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00005781P01

Catalog No. 89-952-314


Add to cart

Description

Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia. [provided by RefSeq]

Sequence: MCLVKGDRRFSDEFTLHEMESGREAGMMEKARGEVLKKKLWKGKFQRGGF
Specifications

Specifications

AAH25181
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.24kDa
Glutathione Sepharose 4 Fast Flow
2 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BPTP3|CFC|MGC14433|NS1|PTP-1D|PTP2C|SH-PTP2|SH-PTP3|SHP2
PTPN11
Yes
wheat germ expression system
Liquid
5781
PTPN11 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MCLVKGDRRFSDEFTLHEMESGREAGMMEKARGEVLKKKLWKGKFQRGGF
RUO
PTPN11
Wheat Germ (in vitro)
GST
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit