Abnova™ Human RAB27A (NP_899059, 1 a.a. - 221 a.a.) Full-length Recombinant Protein with His tag

Catalog No.	Quantity
89-959-084	100 μg

Catalog No. 89-959-084 Supplier Abnova™ Supplier No. P3551

Description

Used for SDS-PAGE

The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Specifications

• Accession Number: NP_899059
• Concentration: 1 mg/mL
• For Use With (Application): SDS-PAGE
• Formulation: Liquid
• Gene ID (Entrez): 5873
• Molecular Weight (g/mol): 27kDa
• Name: RAB27A (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Quantity: 100 μg
• Immunogen: MGSSHHHHHHSSGLVPRGSHMSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
• Storage Requirements: Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: GS2/HsT18676/MGC117246/RAB27/RAM
• Common Name: RAB27A
• Gene Symbol: RAB27A
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: His
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >90% by SDS-PAGE