Abnova™ Human RCV1 Full-length ORF (AAH01720, 1 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-959-669	10 ug
89-959-670	25 ug

Catalog No. 89-959-669 Supplier Abnova™ Supplier No. H00005957P01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq]

Sequence: MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Specifications

• Accession Number: AAH01720
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 5957
• Molecular Weight (g/mol): 47.74kDa
• Name: RCV1 (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: RCV1
• Common Name: RCVRN
• Gene Symbol: RCVRN
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid