Abnova™ Human RNF130 Partial ORF (NP_060904, 28 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-960-186	2 μg

Catalog No. 89-960-186 Supplier Abnova™ Supplier No. H00055819Q01

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells. [provided by RefSeq]

Sequence: DNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNA

Specifications

• Accession Number: NP_060904
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 55819
• Molecular Weight (g/mol): 36.74kDa
• Name: RNF130 (Human) Recombinant Protein (Q01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 2 μg
• Immunogen: DNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: G1RZFP/GOLIATH/GP/MGC117241/MGC138647/MGC99542
• Common Name: RNF130
• Gene Symbol: RNF130
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid