Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human RNPC2 Partial ORF (NP_909122, 423 a.a. - 472 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89960363 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-960-363 25 μg
89-960-362 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-960-363 Supplier Abnova™ Supplier No. H00009584Q01L
Add to Cart
Add to Cart

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is an RNA binding protein and possible splicing factor. The encoded protein is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors. Multiple transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq]

Sequence: TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG

Specifications

Accession Number NP_909122
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 9584
Molecular Weight (g/mol) 31.24kDa
Name RNPC2 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Immunogen TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CAPER/CAPERalpha/CC1.3/DKFZp781C0423/FLJ44170/HCC1/RNPC2/fSAP59
Common Name RBM39
Gene Symbol RBM39
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.