Abnova™ Human SCAND2 Partial ORF (NP_071333, 1 a.a. - 62 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-961-122	25 μg
89-961-121	10 μg

Catalog No. 89-961-122 Supplier Abnova™ Supplier No. H00054581Q02L

Description

Used for AP, Array, ELISA, WB-Re

The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene.

Sequence: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA

Specifications

• Accession Number: NP_071333
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 54581
• Molecular Weight (g/mol): 32.56kDa
• Name: SCAND2 (Human) Recombinant Protein (Q02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Common Name: SCAND2
• Gene Symbol: SCAND2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid