Abnova™ Human SCARA3 Partial ORF (NP_057324, 316 a.a. - 415 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-961-133	25 μg
89-961-132	10 μg

Catalog No. 89-961-133 Supplier Abnova™ Supplier No. H00051435Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a macrophage scavenger receptor-like protein. This protein has been shown to deplete reactive oxygen species, and thus play an important role in protecting cells from oxidative stress. The expression of this gene is induced by oxidative stress. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]

Sequence: SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE

Specifications

• Accession Number: NP_057324
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 51435
• Molecular Weight (g/mol): 36.74kDa
• Name: SCARA3 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: APC7/CSR/CSR1/MSLR1/MSRL1
• Common Name: SCARA3
• Gene Symbol: SCARA3
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid