Invitrogen™ Human SERCA2 ATPase (aa 8-43) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101984	100 μL

Catalog No. RP101984 Supplier Invitrogen™ Supplier No. RP101984

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84558 (PA5-84558. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: P16615
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 488
• Name: Human SERCA2 ATPase (aa 8-43) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9530097L16Rik; ATP2; Atp2a2; ATP2B; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; Ca(2+)-transport ATPase class 3; calcium ATPase; calcium pump 2; calcium-ATPase (EC 3.6.1.3); calcium-transporting ATPase; calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; D5Wsu150e; DAR; DD; endoplasmic reticulum class 1/2 Ca(2+) ATPase; mKIAA4195; putative SERCA isoform; sarco(endo)plasmic reticulum Ca(2+)-dependent ATPase 2; sarco/endoplasmic reticulum Ca2+-ATPase 2; sarcoplasmic reticulum Ca2+-transport ATPase isoform; sarcoplasmic/endoplasmic reticulum calcium ATPase 2; sarcoplasmic/endoplasmic-reticulum Ca(2+) pump gene 2; SERCA; SERCA ATPase; SERCA2; Serca2a; SERCA2B; SercaII; SR Ca(2+)-ATPase 2; unnamed protein product
• Common Name: SERCA2 ATPase
• Gene Symbol: Atp2a2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining