Abnova™ Human SETDB1 Partial ORF (NP_036564, 247 a.a. - 348 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-961-596	25 μg
89-961-595	10 μg

Catalog No. 89-961-596 Supplier Abnova™ Supplier No. H00009869Q02L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a histone methyltransferase. The encoded enzyme catalyzes the reaction of S-adenosyl-L-methionine and histone L-lysine to produce S-adenosyl-L-homocysteine and histone N(6)-methyl-L-lysine. The encoded protein likely functions in transcriptional repression. Alternatively spliced transcript variants have been described

Sequence: IAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLL

Specifications

• Accession Number: NP_036564
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 9869
• Molecular Weight (g/mol): 36.85kDa
• Name: SETDB1 (Human) Recombinant Protein (Q02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Quantity: 25 μg
• Immunogen: IAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ESET/KG1T/KIAA0067/KMT1E
• Common Name: SETDB1
• Gene Symbol: SETDB1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid