Abnova™ Human SGCA Partial ORF (NP_000014.1, 26 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-961-707	10 ug
89-961-708	25 ug

Catalog No. 89-961-707 Supplier Abnova™ Supplier No. H00006442Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a component of the dystrophin-glycoprotein complex (DGC), which is critical to the stability of muscle fiber membranes and to the linking of the actin cytoskeleton to the extracellular matrix. Its expression is thought to be restricted to striated muscle. Mutations in this gene result in type 2D autosomal recessive limb-girdle muscular dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLP

Specifications

• Accession Number: NP_000014.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6442
• Molecular Weight (g/mol): 37.62kDa
• Name: SGCA (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: TTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLP
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: 50-DAG/A2/ADL/DAG2/DMDA2/LGMD2D/SCARMD1/adhalin
• Common Name: SGCA
• Gene Symbol: SGCA
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid