Abnova™ Human SHFM1 Full-length ORF (NP_006295.1, 1 a.a. - 70 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-961-859	25 μg
89-961-858	10 μg

Catalog No. 89-961-859 Supplier Abnova™ Supplier No. H00007979P01L

Description

Used for AP, Array, ELISA, WB-Re

The product of this gene has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle. [provided by RefSeq]

Sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

Specifications

• Accession Number: NP_006295.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7979
• Molecular Weight (g/mol): 34.7kDa
• Name: SHFM1 (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DSS1/ECD/SEM1/SHFD1/SHSF1/Shfdg1
• Common Name: SHFM1
• Gene Symbol: SHFM1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid