Abnova™ Human SHH (Q15465) Recombinant Protein

Catalog No.	Quantity
89-961-865	25 μg

Catalog No. 89-961-865 Supplier Abnova™ Supplier No. P4440

Description

Used for Func, SDS-PAGE

This gene encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of 3 human proteins showing seq and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause o HPE, a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities. Additionally, mutations in a long range enhancer located app. 1 megabase upstream of this gene disrupt limb patterning and can result in preaxial polydactyly.

Sequence: MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Specifications

• Accession Number: Q15465
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 6469
• Molecular Weight (g/mol): 19.7kDa
• Name: SHH (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Quantity: 25 μg
• Immunogen: MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRALDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGGCFP
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: HHG1/HLP3/HPE3/MCOPCB5/SMMCI/TPT/TPTPS
• Common Name: SHH
• Gene Symbol: SHH
• Biological Activity: The activity is determined by the dose-dependent increase of alkaline phosphatase activity by C3H/10T1/2 (CCL-226) fibroblasts. The expected ED50 for this effect is 1.2-1.8μg/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized