Abnova™ Human SLC11A1 Partial ORF (NP_000569.2, 308 a.a. - 350 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-040	10 ug
89-962-041	25 ug

Catalog No. 89-962-040 Supplier Abnova™ Supplier No. H00006556Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq]

Sequence: QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV

Specifications

• Accession Number: NP_000569.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6556
• Molecular Weight (g/mol): 30.47kDa
• Name: SLC11A1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: QAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGV
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: LSH/NRAMP/NRAMP1
• Common Name: SLC11A1
• Gene Symbol: SLC11A1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid