Abnova™ Human SLC11A2 Partial ORF (NP_000608, 1 a.a. - 65 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-044	10 ug
89-962-045	25 ug

Catalog No. 89-962-044 Supplier Abnova™ Supplier No. H00004891Q01S

Description

Used for AP, Array, ELISA, WB-Re

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]

Sequence: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF

Specifications

• Accession Number: NP_000608
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 4891
• Molecular Weight (g/mol): 32.89kDa
• Name: SLC11A2 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DCT1/DMT1/FLJ37416/NRAMP2
• Common Name: SLC11A2
• Gene Symbol: SLC11A2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid