Abnova™ Human SLC12A6 Partial ORF (NP_005126, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-052	10 μg
89-962-053	25 μg

Catalog No. 89-962-052 Supplier Abnova™ Supplier No. H00009990Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy. [provided by RefSeq]

Sequence: MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD

Specifications

• Accession Number: NP_005126
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 9990
• Molecular Weight (g/mol): 35.64kDa
• Name: SLC12A6 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ACCPN/DKFZp434D2135/KCC3/KCC3A/KCC3B
• Common Name: SLC12A6
• Gene Symbol: SLC12A6
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid