Abnova™ Human SLC22A3 Partial ORF (NP_068812, 90 a.a. - 155 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-133	25 ug
89-962-132	10 ug

Catalog No. 89-962-133 Supplier Abnova™ Supplier No. H00006581Q01L

Description

Used for AP, Array, ELISA, WB-Re

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. [provided by RefSeq]

Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD

Specifications

• Accession Number: NP_068812
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6581
• Molecular Weight (g/mol): 33kDa
• Name: SLC22A3 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: EMT/EMTH/OCT3
• Common Name: SLC22A3
• Gene Symbol: SLC22A3
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid