Abnova™ Human SLC25A21 Partial ORF (NP_085134.1, 36 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-174	10 μg
89-962-175	25 μg

Catalog No. 89-962-174 Supplier Abnova™ Supplier No. H00089874Q01S

Description

Used for AP, Array, ELISA, WB-Re

SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.[supplied by OMIM]

Sequence: VVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKK

Specifications

• Accession Number: NP_085134.1
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 89874
• Molecular Weight (g/mol): 32.78kDa
• Name: SLC25A21 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: VVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKK
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MGC126570/ODC/ODC1
• Common Name: SLC25A21
• Gene Symbol: SLC25A21
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid