Abnova™ Human SLC2A4 Partial ORF (NP_001033, 467 a.a. - 509 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-265	10 ug
89-962-266	25 ug

Catalog No. 89-962-265 Supplier Abnova™ Supplier No. H00006517Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]

Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND

Specifications

• Accession Number: NP_001033
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6517
• Molecular Weight (g/mol): 30.47kDa
• Name: SLC2A4 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: GLUT4
• Common Name: SLC2A4
• Gene Symbol: SLC2A4
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid