Abnova™ Human SLC39A13 Partial ORF (NP_689477.2, 170 a.a. - 226 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-331	10 μg
89-962-332	25 μg

Catalog No. 89-962-331 Supplier Abnova™ Supplier No. H00091252Q01S

Description

Used for AP, Array, ELISA, WB-Re

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A13 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM]

Sequence: LDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANT

Specifications

• Accession Number: NP_689477.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 91252
• Molecular Weight (g/mol): 32.01kDa
• Name: SLC39A13 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: LDSKEEGTSQAPNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANT
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: FLJ25785
• Common Name: SLC39A13
• Gene Symbol: SLC39A13
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid