Abnova™ Human SLC6A20 Partial ORF (NP_064593, 301 a.a. - 369 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-395	10 μg
89-962-396	25 μg

Catalog No. 89-962-395 Supplier Abnova™ Supplier No. H00054716Q01S

Description

Used for AP, Array, ELISA, WB-Re

Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene is a member of the subgroup of transporter with unidentified substrates within the Na+ and Cl- coupled transporter family. This gene is expressed in kidney, and its alternative splicing generates 2 transcript variants. [provided by RefSeq]

Sequence: KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ

Specifications

• Accession Number: NP_064593
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 54716
• Molecular Weight (g/mol): 33.33kDa
• Name: SLC6A20 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MGC161475/SIT1/XT3/Xtrp3
• Common Name: SLC6A20
• Gene Symbol: SLC6A20
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid