Abnova™ Human SLC7A7 Partial ORF (NP_003973.2, 462 a.a. - 511 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-421	10 μg
89-962-422	25 μg

Catalog No. 89-962-421 Supplier Abnova™ Supplier No. H00009056Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

Specifications

• Accession Number: NP_003973.2
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 9056
• Molecular Weight (g/mol): 31.24kDa
• Name: SLC7A7 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: LAT3/LPI/MOP-2/Y+LAT1/y+LAT-1
• Common Name: SLC7A7
• Gene Symbol: SLC7A7
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid