Abnova™ Human SLCO1B1 Partial ORF (NP_006437, 481 a.a. - 570 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-448	10 μg
89-962-449	25 μg

Catalog No. 89-962-448 Supplier Abnova™ Supplier No. H00010599Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a liver-specific member of the organic anion transporter family. The encoded protein is a transmembrane receptor that mediates the sodium-independent uptake of numerous endogenous compounds including bilirubin, 17-beta-glucuronosyl estradiol and leukotriene C4. This protein is also involved in the removal of drug compounds such as statins, bromosulfophthalein and rifampin from the blood into the hepatocytes. Polymorphisms in the gene encoding this protein are associated with impaired transporter function. [provided by RefSeq]

Sequence: YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL

Specifications

• Accession Number: NP_006437
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 10599
• Molecular Weight (g/mol): 35.64kDa
• Name: SLCO1B1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: LST-1/LST1/MGC133282/OATP-C/OATP1B1/OATP2/OATPC/SLC21A6
• Common Name: SLCO1B1
• Gene Symbol: SLCO1B1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid