Abnova™ Human SLPI Partial ORF (NP_003055, 33 a.a. - 132 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-472	10 ug
89-962-473	25 ug

Catalog No. 89-962-472 Supplier Abnova™ Supplier No. H00006590Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity. [provided by RefSeq]

Sequence: GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

Specifications

• Accession Number: NP_003055
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6590
• Molecular Weight (g/mol): 36.74kDa
• Name: SLPI (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: GVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ALK1/ALP/BLPI/HUSI/HUSI-I/MPI/WAP4/WFDC4
• Common Name: SLPI
• Gene Symbol: SLPI
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid