Abnova™ Human SLURP1 Partial ORF (NP_065160, 25 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-479	25 μg
89-962-478	10 μg

Catalog No. 89-962-479 Supplier Abnova™ Supplier No. H00057152Q01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq]

Sequence: CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE

Specifications

• Accession Number: NP_065160
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 57152
• Molecular Weight (g/mol): 34.32kDa
• Name: SLURP1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ANUP/ARS/ArsB/LY6LS/MDM
• Common Name: SLURP1
• Gene Symbol: SLURP1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid