Abnova™ Human SMARCD1 Partial ORF (NP_003067, 1 a.a. - 63 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-546	25 ug
89-962-545	10 ug

Catalog No. 89-962-546 Supplier Abnova™ Supplier No. H00006602Q01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKR

Specifications

• Accession Number: NP_003067
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6602
• Molecular Weight (g/mol): 32.67kDa
• Name: SMARCD1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKR
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: BAF60A/CRACD1/Rsc6p
• Common Name: SMARCD1
• Gene Symbol: SMARCD1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid