Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human SNF8 Partial ORF (NP_009172, 23 a.a. - 122 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human SNF8 Partial ORF (NP_009172, 23 a.a. - 122 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89962709 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-962-709 25 μg
89-962-708 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-962-709 Supplier Abnova™ Supplier No. H00011267Q01L

Description

Used for AP, Array, ELISA, WB-Re

SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM]

Sequence: ERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLE

Specifications

Accession Number NP_009172
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 11267
Molecular Weight (g/mol) 36.74kDa
Name SNF8 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Immunogen ERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLE
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias Dot3/EAP30/VPS22
Common Name SNF8
Gene Symbol SNF8
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.