Abnova™ Human SNX7 Partial ORF (NP_057060, 120 a.a. - 226 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-790	10 μg
89-962-791	25 μg

Catalog No. 89-962-790 Supplier Abnova™ Supplier No. H00051375Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like some family members, and its function is unknown. This gene results in two transcript variants encoding two distinct isoforms. [provided by RefSeq]

Sequence: ALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSPHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGP

Specifications

• Accession Number: NP_057060
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 51375
• Molecular Weight (g/mol): 37.51kDa
• Name: SNX7 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: ALHKFLNRIADHPTLTFNEDFKIFLTAQAWELSPHKKQGPGLLSRMGQTVRAVASSMRGVKNRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGP
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DKFZp564F052/MGC8717
• Common Name: SNX7
• Gene Symbol: SNX7
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid