Abnova™ Human SOAT1 Partial ORF (NP_003092.4, 249 a.a. - 321 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-798	25 ug
89-962-797	10 ug

Catalog No. 89-962-798 Supplier Abnova™ Supplier No. H00006646Q01L

Description

Used for AP, Array, ELISA, WB-Re

Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al., 1988 [PubMed 3335499]).[supplied by OMIM]

Sequence: PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWG

Specifications

• Accession Number: NP_003092.4
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6646
• Molecular Weight (g/mol): 33.77kDa
• Name: SOAT1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWG
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: ACACT/ACAT/ACAT1/RP11-215I23.2/SOAT/STAT
• Common Name: SOAT1
• Gene Symbol: SOAT1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid