Abnova™ Human SOX21 Partial ORF (NP_009015, 224 a.a. - 265 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-962-874	10 μg
89-962-875	25 μg

Catalog No. 89-962-874 Supplier Abnova™ Supplier No. H00011166Q01S

Description

Used for AP, Array, ELISA, WB-Re

SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM]

Sequence: HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL

Specifications

• Accession Number: NP_009015
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 11166
• Molecular Weight (g/mol): 30.36kDa
• Name: SOX21 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: SOX25
• Common Name: SOX21
• Gene Symbol: SOX21
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid