Abnova™ Human SPINK1 Partial ORF (AAH25790, 24 a.a. - 79 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-963-057	10 ug
89-963-058	25 ug

Catalog No. 89-963-057 Supplier Abnova™ Supplier No. H00006690Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis. [provided by RefSeq]

Sequence: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Specifications

• Accession Number: AAH25790
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6690
• Molecular Weight (g/mol): 31.9kDa
• Name: SPINK1 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 ug
• Immunogen: DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: PCTT/PSTI/Spink3/TATI
• Common Name: SPINK1
• Gene Symbol: SPINK1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid