Abnova™ Human ST3GAL2 Partial ORF (NP_008858, 28 a.a. - 127 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-963-360	25 ug
89-963-359	10 ug

Catalog No. 89-963-360 Supplier Abnova™ Supplier No. H00006483Q01L

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq]

Sequence: HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV

Specifications

• Accession Number: NP_008858
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 6483
• Molecular Weight (g/mol): 36.74kDa
• Name: ST3GAL2 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 ug
• Immunogen: HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: Gal-NAc6S/SIAT4B/ST3GALII/ST3GalA.2
• Common Name: ST3GAL2
• Gene Symbol: ST3GAL2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid