Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human ST6GAL1 Partial ORF (NP_775323, 96 a.a. - 195 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89961903 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 ug
25 ug
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-961-903 25 ug
89-961-902 10 ug
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-961-903 Supplier Abnova™ Supplier No. H00006480Q01L

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Three transcript variants encoding two different isoforms have been described. [provided by RefSeq]

Sequence: WNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKS

Specifications

Accession Number NP_775323
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 6480
Molecular Weight (g/mol) 36.74kDa
Name ST6GAL1 (Human) Recombinant Protein (Q01)
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 ug
Immunogen WNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKS
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CD75/MGC48859/SIAT1/ST6GalI/ST6N
Common Name ST6GAL1
Gene Symbol ST6GAL1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.