Abnova™ Human SYNE2 Partial ORF (NP_055995, 6702 a.a. - 6799 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-963-903	10 μg
89-963-904	25 μg

Catalog No. 89-963-903 Supplier Abnova™ Supplier No. H00023224Q01S

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a nuclear outer membrane protein that binds cytoplasmic F-actin. This binding tethers the nucleus to the cytoskeleton and aids in the maintenance of the structural integrity of the nucleus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA

Specifications

• Accession Number: NP_055995
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 23224
• Molecular Weight (g/mol): 36.52kDa
• Name: SYNE2 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DKFZp434H2235/DKFZp686E01115/DKFZp686H1931/FLJ11014/FLJ43727/FLJ45710/FLJ46790/KIAA1011/NUA/NUANCE/Nesprin-2/SYNE-2
• Common Name: SYNE2
• Gene Symbol: SYNE2
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid