Abnova™ Human TAB3 Partial ORF (NP_690000, 58 a.a. - 149 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-963-956	10 μg
89-963-957	25 μg

Catalog No. 89-963-956 Supplier Abnova™ Supplier No. H00257397Q01S

Description

Used for AP, Array, ELISA, WB-Re

The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Sequence: YHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQNRSA

Specifications

• Accession Number: NP_690000
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 257397
• Molecular Weight (g/mol): 35.86kDa
• Name: TAB3 (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: YHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICLVQEPHSAPAVVAATPNYNPFFMNEQNRSA
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MGC45404/NAP1/TAB3
• Common Name: MAP3K7IP3
• Gene Symbol: MAP3K7IP3
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid