Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human TAF1D (aa 8-113) Control Fragment Recombinant Protein

Catalog No. RP108795
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108795 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108795 Supplier Invitrogen™ Supplier No. RP108795
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140055 (PA5-140055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAF1D is a member of the SL1 complex, which includes TBP (MIM 600075) and TAF1A (MIM 604903), TAF1B (MIM 604904), and TAF1C (MIM 604905), and plays a role in RNA polymerase I transcription.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H5J8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79101
Name Human TAF1D (aa 8-113) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810003M17Rik; 4930553M18Rik; 5930426I11Rik; JOSD3; Josephin domain containing 3; RAFI41; RNA polymerase I-specific TBP-associated factor 41 kDa; TAF(I)41; TAF1D; TAFI41; TATA box binding protein (Tbp)-associated factor, RNA polymerase I, D; TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41 kDa; TATA box binding protein associated factor 1 D; TATA box binding protein-associated factor, RNA polymerase I, D; TATA box-binding protein-associated factor 1 D; TATA box-binding protein-associated factor RNA polymerase I subunit D; TATA-box binding protein associated factor, RNA polymerase I subunit D; TATA-box binding protein associated factor, RNA polymerase I, D; TBP-associated factor 1 D; Transcription initiation factor SL1/TIF-IB subunit D
Common Name TAF1D
Gene Symbol TAF1D
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVHASDSSSDSSFEPIPLTIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.