Invitrogen™ Human TAF8 (aa 18-79) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94874	100 μL

Catalog No. RP94874 Supplier Invitrogen™ Supplier No. RP94874

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56839 (PA5-56839. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. Mediates both basal and activator-dependent transcription. Plays a role in the differentiation of preadipocyte fibroblasts to adipocytes, however, does not seem to play a role in differentiation of myoblasts. Required for the integration of TAF10 in the TAF complex. May be important for survival of cells of the inner cell mass which constitute the pluripotent cell population of the early embryo.

Specifications

• Accession Number: Q7Z7C8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 129685
• Name: Human TAF8 (aa 18-79) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW260255; hTAFII43; II; Protein taube nuss; Protein taube nuss-like; similar to taube nuss; TAF; TAF(II)43; TAF8; TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43 kDa; TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factorq; TAFII43; TAFII-43; TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 45/50 kDa; TATA box binding protein associated factor 8; TATA-box binding protein associated factor 8; taube nuss; taube nuss homolog; TBN; tbnl; tbnl protein; TBP-associated factor 43 kDa; TBP-associated factor 8; TBP-associated factor TAFII43; TBP-associated factor, RNA polymerase II, 43 kD; transcription initiation factor TFIID 43 kDa subunit; Transcription initiation factor TFIID subunit 8; zgc:56401; zgc:77837
• Common Name: TAF8
• Gene Symbol: TAF8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining