Abnova™ Human TGFB1 Partial ORF (NP_000651, 279 a.a. - 390 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-964-529	10μg
89-964-530	25μg

Catalog No. 89-964-529 Supplier Abnova™ Supplier No. H00007040Q02S

Description

Used for AP, Array, ELISA, WB-Re

TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM]

Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Specifications

• Accession Number: NP_000651
• For Use With (Application): Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 7040
• Molecular Weight (g/mol): 38.06kDa
• Name: Human TGFB1 Partial ORF (NP_000651, 279 a.a. - 390 a.a.) Recombinant Protein with GST-tag at N-terminal
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10μg
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: CED, DPD1, TGFB, TGFbeta
• Common Name: TGFB1
• Gene Symbol: TGFB1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST Tag
• Expression System: wheat germ expression system
• Form: Liquid