Abnova™ Human THEA Partial ORF (AAH01517, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-964-645	25 μg
89-964-644	10 μg

Catalog No. 89-964-645 Supplier Abnova™ Supplier No. H00026027Q01L

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: MADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDLCSEKQWNVCK

Specifications

• Accession Number: AAH01517
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 26027
• Molecular Weight (g/mol): 37.73kDa
• Name: THEA (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: MADGEGYRNPTEVQMSQLVLPCHTNQRGELSVGQLLKWIDTTACLSAERHAGCPCVTASMDDIYFEHTISVGQVVNIKAKVNRAFNSSMEVGIQVASEDLCSEKQWNVCK
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: BFIT/BFIT1/BFIT2/KIAA0707/STARD14/THEA/THEM1
• Common Name: ACOT11
• Gene Symbol: ACOT11
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid