Abnova™ Human TMIE Partial ORF (NP_671729, 79 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No.	Quantity
89-965-068	10 μg
89-965-069	25 μg

Catalog No. 89-965-068 Supplier Abnova™ Supplier No. H00259236Q01S

Description

Used for AP, Array, ELISA, WB-Re

This gene encodes a transmembrane inner ear protein. Studies in mouse suggest that this gene is required for normal postnatal maturation of sensory hair cells in the cochlea, including correct development of stereocilia bundles. This gene is one of multiple genes responsible for recessive non-syndromic deafness (DFNB), also known as autosomal recessive nonsyndromic hearing loss (ARNSHL), the most common form of congenitally acquired inherited hearing impairment. [provided by RefSeq]

Sequence: NCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV

Specifications

• Accession Number: NP_671729
• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 259236
• Molecular Weight (g/mol): 32.56kDa
• Name: TMIE (Human) Recombinant Protein (Q01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Immunogen: NCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKV
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DFNB6
• Common Name: TMIE
• Gene Symbol: TMIE
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid